PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009596675.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 179aa    MW: 20545.3 Da    PI: 8.8245
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009596675.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+++Ed++l+d+++q+G g+W+  ++  g+ R++k+c++rw +yl
   XP_009596675.1 14 RGAWSKQEDQKLIDYITQHGEGCWRNLPKAAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding57.53e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++Ed+l+++++++lG++ W++Ia +++ gRt++++k++w+++l
   XP_009596675.1  67 RGNFSEDEDDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.965961IPR017930Myb domain
SuperFamilySSF466894.03E-2912108IPR009057Homeodomain-like
SMARTSM007171.2E-121363IPR001005SANT/Myb domain
PfamPF002492.8E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-231568IPR009057Homeodomain-like
CDDcd001671.79E-101661No hitNo description
PROSITE profilePS5129427.88262116IPR017930Myb domain
SMARTSM007171.8E-1766114IPR001005SANT/Myb domain
PfamPF002497.7E-1767112IPR001005SANT/Myb domain
CDDcd001671.99E-1269112No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2769117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MRKTCCDNKE EMHRGAWSKQ EDQKLIDYIT QHGEGCWRNL PKAAGLLRCG KSCRLRWMNY  60
LSPNIKRGNF SEDEDDLIIK LHALLGNRWS LIAGRLPGRT DNEVKNYWNS HLRRKLIKMG  120
IDPNNHLISH YLHRKSLEFW PENSKTDGSL LSDAGSSCAN DQQPIGSLPD LNSLPSIHP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-311111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9850231e-158KF985023.1 Petunia x hybrida cultivar Mitchell R2R3-MYB anthocyanin repressor (MYB27) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009596675.11e-131PREDICTED: transcription factor MYB3-like
SwissprotQ9S9K92e-68MYB3_ARATH; Transcription factor MYB3
TrEMBLA0A023PKB41e-108A0A023PKB4_PETHY; R2R3-MYB anthocyanin repressor
STRINGPGSC0003DMT4000784771e-102(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.11e-69myb domain protein 3